Skip to content
Oboe Travels · Maldives

Noonu Atoll

Velaa Private Island Maldives

Velaa Private Island sits in Noonu Atoll, reached by a 45-minute seaplane transfer, and was built from the ground up as an ultra-exclusive boutique hideaway. Its name means "Turtle Island" in Dhivehi, a nod to the generations of sea turtles that nest here, and the theme runs through the resort's design — turtle motifs and shell patterns appear throughout, and the overwater villas are laid out to echo a turtle's head and body when seen from above. At under 20 hectares, the island stays intimate: just 43 villas across beach, water and multi-bedroom residence categories, including a four-bedroom private residence built for larger groups. Six restaurants and a 500-bin wine cellar (among the largest in the Maldives) anchor the dining side, while a Guerlain spa, a Jose Maria Olazabal-designed golf academy, and a PADI dive centre round out a stay built around family time, honeymoons and understated ultra-luxury.

ultra-luxuryluxuryhoneymoonfamily-friendlydivingseaplane-accesswellness
Velaa Private Island Maldives

Room Types

Beach Pool Villa at Velaa Private Island Maldives - photo 1
1/5

Beach Pool Villa

This detached one-bedroom villa leans into a colonial mood, with louvered mahogany panels, tall ceilings and teak furniture set against wall-to-wall glass doors that open onto a private terrace and pool. Palm clusters keep it shaded and secluded through the day. An indoor bathroom with twin basins connects through a garden atrium to a large open-air bathroom and an oversized tub under a gazebo, while day beds and an alfresco dining spot face straight out to the ocean.

Deluxe Beach Pool Villa at Velaa Private Island Maldives - photo 1
1/3

Deluxe Beach Pool Villa

Natural materials and a suspended chair set a playful, refined tone in this one-bedroom beachfront villa, which adds a larger separate living room alongside its private terrace and pool. The Zen-inspired outdoor bathroom pairs a deep bath with a garden-atrium daybed, and the poolside dining spot comes into its own at sunset.

Beach Pool House at Velaa Private Island Maldives - photo 1
1/4

Beach Pool House

Built for families, this two-bedroom beachfront house centres on a large living area that doubles as a daytime retreat and evening gathering spot, with a bar-equipped kitchen for casual meals. Louvered wood and vaulted ceilings shape the bedrooms, while outside a spacious terrace holds a large private pool, day beds and a standalone dining platform facing the lagoon.

Velaa Private Residence at Velaa Private Island Maldives - photo 1
1/6

Velaa Private Residence

A rare four-bedroom offering for up to 10 guests, spread across roughly 1,350 square metres of interior and exterior space including two terraces, a pool and a courtyard. The two-storey layout gives every bedroom an ocean view — first-floor rooms open to wide balconies, ground-floor rooms open straight onto the pool — while a private gym and spa room sit tucked behind the main living space.

Sunrise Water Pool Villa at Velaa Private Island Maldives - photo 1
1/4

Sunrise Water Pool Villa

Set along an extended jetty for uninterrupted ocean views, this villa pairs a thatch-shaded dining area with a bedroom and bathroom that open straight onto a terrace, pool and sun deck, with steps down into the sea. Inside, a floor-set viewing window and an ocean-facing bed keep the water always in sight.

Sunset Deluxe Water Pool Villa at Velaa Private Island Maldives - photo 1
1/3

Sunset Deluxe Water Pool Villa

Angled toward the sunset and screened by canvas sails for extra privacy, this villa adds a private wine fridge and bar to its living area, plus circular baths and a swinging chair in oversized bathrooms. A gazebo daybed on the sun deck catches the day's last light, with steps leading straight into the lagoon.

Ocean Pool House at Velaa Private Island Maldives - photo 1
1/5

Ocean Pool House

Set at the island's tip in its own private domain, this two-bedroom overwater residence wraps thatch roofing around louvered shutters and a deep, cushion-covered sofa. Two bathrooms with circular baths look out to the ocean, and a private pool leads to a sun deck with two gazebos — one with a sunken hot tub, the other set up for lounging.

Romantic Pool Residence at Velaa Private Island Maldives - photo 1
1/6

Romantic Pool Residence

Reachable only by boat, this one-bedroom villa hangs above the lagoon for maximum privacy, aimed squarely at honeymooners. A Jacuzzi, pool, sun deck and sunken bath all open off the terraces, and dinner can move to an over-water gazebo on its own jetty. A private gym and spa treatment room round out a residence built so guests rarely need to leave.

Dining

Athiri

International

A beachfront à la carte restaurant open through the day, from a fresh-fruit buffet breakfast to wood-fired pizzas and a sunset-facing menu of Athiri specialties.

Avi

Bar

A poolside bar with its own mixologist and live DJ, running casual by day and shifting into a livelier cocktail scene after dark.

Tavaru

Japanese Teppanyaki

A Teppanyaki grill restaurant where chefs prepare bespoke sharing menus tableside, plus a newer lunchtime Bento Box concept built around the same craft.

Wine Cellar

Wine Cellar

Housed in the Tavaru Tower, this cellar holds over 500 bins — reportedly the largest wine collection in the Maldives — spanning boutique producers to rare vintage finds.

Aragu

Modern European

A modern European kitchen built around organic, globally sourced produce, pairing classical technique with a contemporary, sustainability-minded menu.

Cru

Champagne Lounge

An ocean-view champagne lounge where sommeliers guide guests through some of the world's rarest champagnes.

Activities

  • Spa

    The spa is one of only a handful worldwide partnered with this level of skincare brand, offering exclusive facial and body treatments alongside a fully personalised approach.

  • Golf Academy

    Designed by Jose Maria Olazabal and run by Troon, the academy pairs a state-of-the-art simulator and swing studio with tailored coaching, a putting green and family-friendly programmes.

  • Water Sports

    Seadoo scooters are available to reach the island's coral reef for some of the resort's best snorkelling.

  • Diving

    The Scubapro-equipped, PADI-affiliated dive centre sends divers to unexplored sites around Noonu Atoll, with regular sightings of grey reef and nurse sharks, seasonal manta rays, and eagle rays.

  • Land Sports

    A Technogym-equipped fitness centre covers land-based training with current equipment and studio space.

  • Excursions

    Traditional dhoni cruises, dolphin encounters and snorkelling trips give guests a way to explore the surrounding reef and open water.

  • Kids Club

    The Lha Velaa ("Little Turtle") Club runs structured activities and rainy-day programming for younger guests to make friends and learn new skills while parents get time to themselves.

  • Library

    An extensive on-site library gives guests and children a quiet retreat for slower days.

  • Shopping

    An on-site boutique stocks clothing, jewellery, resort products and water sports and golf gear, alongside a spa boutique carrying premium skincare lines.

Transfers

45-minute seaplane transfer from Velana International Airport to Noonu Atoll

Policies

Check-in, check-out, cancellation and other resort-specific policies are confirmed directly with the resort at the time of booking.

Related Resorts

Cheval Blanc Randheli

Noonu Atoll

Cheval Blanc Randheli

Reached by a 40-minute seaplane flight into Noonu Atoll, Cheval Blanc Randheli pairs French sophistication with a Maldivian setting, designed by architect Jean-Michel Gathy to sit gracefully between contemporary form and island tradition. The result feels understated rather than showy, with clean architectural lines softened by local materials and craft. Villas draw on natural textures like rattan, bamboo, mother-of-pearl, and coral, set against a bright palette that occasionally flashes yellow or green against otherwise quiet interiors. Every stay is built around the maison's French ‘Art de Recevoir’ philosophy, with a dedicated team of Alchemists on hand to shape bespoke experiences and excursions for each guest. The island's restaurants and bars carry a distinctly French sense of gastronomy, from signature fine dining to a dedicated wine museum and cigar lounge, while diving trips explore the surrounding reefs of Noonu Atoll and a Guerlain-designed spa rounds out the wellness side of the stay.

View Resort
Noku Maldives Resort

Noonu Atoll

Noku Maldives Resort

Fifty private villas spread across Kuda Funafaru in Noonu Atoll make up Noku Maldives Resort, a getaway built around generous space and unhurried calm. The surrounding lagoon glows in every shade of blue and shelters an active marine community, including a resident sea turtle guests often spot while wading in from the beach. Climb aboard the resort's traditional dhoni sailing boat for a chance to watch spinner dolphins at play, or simply let the tropical scenery set the pace for the day. Villas split between beachfront and overwater settings, each pairing clean, modern lines with dark timber accents and soft neutral tones for an understated island feel. Evenings unfold over international menus that draw on flavours from across Asia, while Noku Spa offers holistic treatments rooted in nature just steps from a peaceful garden pathway. Getting here means a scenic 45-minute seaplane journey from Velana International Airport, or a shorter domestic flight to Maafaru followed by a quick speedboat transfer, delivering guests to an island ecosystem rich with rays, dolphins, and colourful reef fish — a natural playground for divers, snorkellers, and families alike.

View Resort
Soneva Jani

Noonu Atoll

Soneva Jani

Soneva Jani sits in Noonu Atoll, around 30 minutes from Malé by seaplane, spread across a lagoon so open that nearly every villa feels like its own private island. The 25 water and island villas lean fully into castaway-chic design, with retractable roofs for stargazing from bed, water slides curling down into the lagoon, and interiors built from a mix of raw natural materials and quiet, understated luxury. The resort's list of firsts sets it apart even among Maldivian ultra-luxury properties: the region's first overwater observatory, an overwater silent cinema called Cinema Paradiso, and a wine tower stocked largely with organic and biodynamic labels anchor an island built around genuine originality. Dining spans a crab-focused restaurant and bar, a Japanese kitchen paired with classic film screenings, and a monthly full moon dinner served on the sandbar, while activities range from astronomy cruises and dolphin safaris to the world's first fully sustainable surfing programme. It's a resort built for families and couples alike who want ultra-luxury delivered with a genuine sense of imagination.

View Resort